Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA047704-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: paired box 2
Gene Name: PAX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004231: 98%, ENSRNOG00000014253: 100%
Entrez Gene ID: 5076
Uniprot ID: Q02962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD
Gene Sequence FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD
Gene ID - Mouse ENSMUSG00000004231
Gene ID - Rat ENSRNOG00000014253
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation)
Datasheet Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation)
Datasheet Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation)
Citations for Anti PAX2 pAb (ATL-HPA047704 w/enhanced validation) – 2 Found
Larsson, Max. Non-canonical heterogeneous cellular distribution and co-localization of CaMKIIα and CaMKIIβ in the spinal superficial dorsal horn. Brain Structure & Function. 2018;223(3):1437-1457.  PubMed
Gutierrez-Mecinas, Maria; Bell, Andrew; Polgár, Erika; Watanabe, Masahiko; Todd, Andrew J. Expression of Neuropeptide FF Defines a Population of Excitatory Interneurons in the Superficial Dorsal Horn of the Mouse Spinal Cord that Respond to Noxious and Pruritic Stimuli. Neuroscience. 2019;416( 31421202):281-293.  PubMed