Anti PAWR pAb (ATL-HPA012640 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012640-25

Protein Description: PRKC, apoptosis, WT1, regulator
Gene Name: PAWR
Alternative Gene Name: par-4, PAR4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035873: 82%, ENSRNOG00000005917: 78%
Entrez Gene ID: 5074
Uniprot ID: Q96IZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT
• Gene Sequence: LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT
• Gene ID - Mouse: ENSMUSG00000035873
• Gene ID - Rat: ENSRNOG00000005917
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PAWR pAb (ATL-HPA012640 w/enhanced validation) – 1 Found

Fabi, François; Grenier, Kathy; Parent, Sophie; Adam, Pascal; Tardif, Laurence; Leblanc, Valérie; Asselin, Eric. Regulation of the PI3K/Akt pathway during decidualization of endometrial stromal cells. Plos One. 12(5):e0177387.