Anti PATZ1 pAb (ATL-HPA047893)

Atlas Antibodies

Catalog No.:
ATL-HPA047893-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: POZ (BTB) and AT hook containing zinc finger 1
Gene Name: PATZ1
Alternative Gene Name: dJ400N23, MAZR, PATZ, RIAZ, ZBTB19, ZNF278, ZSG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020453: 100%, ENSRNOG00000018709: 100%
Entrez Gene ID: 23598
Uniprot ID: Q9HBE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEI
Gene Sequence LLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEI
Gene ID - Mouse ENSMUSG00000020453
Gene ID - Rat ENSRNOG00000018709
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PATZ1 pAb (ATL-HPA047893)
Datasheet Anti PATZ1 pAb (ATL-HPA047893) Datasheet (External Link)
Vendor Page Anti PATZ1 pAb (ATL-HPA047893) at Atlas Antibodies

Documents & Links for Anti PATZ1 pAb (ATL-HPA047893)
Datasheet Anti PATZ1 pAb (ATL-HPA047893) Datasheet (External Link)
Vendor Page Anti PATZ1 pAb (ATL-HPA047893)