Anti PARS2 pAb (ATL-HPA028518)

Atlas Antibodies

Catalog No.: ATL-HPA028518-25

Protein Description: prolyl-tRNA synthetase 2, mitochondrial (putative)
Gene Name: PARS2
Alternative Gene Name: DKFZp727A071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043572: 85%, ENSRNOG00000007327: 85%
Entrez Gene ID: 25973
Uniprot ID: Q7L3T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGLGVTRILAAAIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEAVPQLHGEVLLDDRTHLTIGNRLKDANKFGYP
• Gene Sequence: YGLGVTRILAAAIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEAVPQLHGEVLLDDRTHLTIGNRLKDANKFGYP
• Gene ID - Mouse: ENSMUSG00000043572
• Gene ID - Rat: ENSRNOG00000007327
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.