Anti PARP3 pAb (ATL-HPA067657)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067657-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PARP3
Alternative Gene Name: ADPRT3, ADPRTL3, hPARP-3, IRT1, pADPRT-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023249: 82%, ENSRNOG00000012865: 82%
Entrez Gene ID: 10039
Uniprot ID: Q9Y6F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV |
| Gene Sequence | LSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV |
| Gene ID - Mouse | ENSMUSG00000023249 |
| Gene ID - Rat | ENSRNOG00000012865 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PARP3 pAb (ATL-HPA067657) | |
| Datasheet | Anti PARP3 pAb (ATL-HPA067657) Datasheet (External Link) |
| Vendor Page | Anti PARP3 pAb (ATL-HPA067657) at Atlas Antibodies |
| Documents & Links for Anti PARP3 pAb (ATL-HPA067657) | |
| Datasheet | Anti PARP3 pAb (ATL-HPA067657) Datasheet (External Link) |
| Vendor Page | Anti PARP3 pAb (ATL-HPA067657) |
| Citations for Anti PARP3 pAb (ATL-HPA067657) – 1 Found |
| Chan, Chung Ying; Hopkins, Samantha L; Guibbal, Florian; Pacelli, Anna; Baguña Torres, Julia; Mosley, Michael; Lau, Doreen; Isenegger, Patrick; Chen, Zijun; Wilson, Thomas C; Dias, Gemma; Hueting, Rebekka; Gouverneur, Véronique; Cornelissen, Bart. Correlation between molar activity, injection mass and uptake of the PARP targeting radiotracer [(18)F]olaparib in mouse models of glioma. Ejnmmi Research. 2022;12(1):67. PubMed |