Anti PARP3 pAb (ATL-HPA067657)

Atlas Antibodies

Catalog No.:
ATL-HPA067657-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: poly (ADP-ribose) polymerase family, member 3
Gene Name: PARP3
Alternative Gene Name: ADPRT3, ADPRTL3, hPARP-3, IRT1, pADPRT-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023249: 82%, ENSRNOG00000012865: 82%
Entrez Gene ID: 10039
Uniprot ID: Q9Y6F1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV
Gene Sequence LSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV
Gene ID - Mouse ENSMUSG00000023249
Gene ID - Rat ENSRNOG00000012865
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PARP3 pAb (ATL-HPA067657)
Datasheet Anti PARP3 pAb (ATL-HPA067657) Datasheet (External Link)
Vendor Page Anti PARP3 pAb (ATL-HPA067657) at Atlas Antibodies

Documents & Links for Anti PARP3 pAb (ATL-HPA067657)
Datasheet Anti PARP3 pAb (ATL-HPA067657) Datasheet (External Link)
Vendor Page Anti PARP3 pAb (ATL-HPA067657)
Citations for Anti PARP3 pAb (ATL-HPA067657) – 1 Found
Chan, Chung Ying; Hopkins, Samantha L; Guibbal, Florian; Pacelli, Anna; Baguña Torres, Julia; Mosley, Michael; Lau, Doreen; Isenegger, Patrick; Chen, Zijun; Wilson, Thomas C; Dias, Gemma; Hueting, Rebekka; Gouverneur, Véronique; Cornelissen, Bart. Correlation between molar activity, injection mass and uptake of the PARP targeting radiotracer [(18)F]olaparib in mouse models of glioma. Ejnmmi Research. 2022;12(1):67.  PubMed