Anti PARP10 pAb (ATL-HPA052427)

Atlas Antibodies

Catalog No.:
ATL-HPA052427-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: poly (ADP-ribose) polymerase family, member 10
Gene Name: PARP10
Alternative Gene Name: FLJ14464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063268: 62%, ENSRNOG00000004361: 62%
Entrez Gene ID: 84875
Uniprot ID: Q53GL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG
Gene Sequence LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG
Gene ID - Mouse ENSMUSG00000063268
Gene ID - Rat ENSRNOG00000004361
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PARP10 pAb (ATL-HPA052427)
Datasheet Anti PARP10 pAb (ATL-HPA052427) Datasheet (External Link)
Vendor Page Anti PARP10 pAb (ATL-HPA052427) at Atlas Antibodies

Documents & Links for Anti PARP10 pAb (ATL-HPA052427)
Datasheet Anti PARP10 pAb (ATL-HPA052427) Datasheet (External Link)
Vendor Page Anti PARP10 pAb (ATL-HPA052427)