Anti PARP10 pAb (ATL-HPA052427)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052427-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PARP10
Alternative Gene Name: FLJ14464
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063268: 62%, ENSRNOG00000004361: 62%
Entrez Gene ID: 84875
Uniprot ID: Q53GL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG |
Gene Sequence | LVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCG |
Gene ID - Mouse | ENSMUSG00000063268 |
Gene ID - Rat | ENSRNOG00000004361 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PARP10 pAb (ATL-HPA052427) | |
Datasheet | Anti PARP10 pAb (ATL-HPA052427) Datasheet (External Link) |
Vendor Page | Anti PARP10 pAb (ATL-HPA052427) at Atlas Antibodies |
Documents & Links for Anti PARP10 pAb (ATL-HPA052427) | |
Datasheet | Anti PARP10 pAb (ATL-HPA052427) Datasheet (External Link) |
Vendor Page | Anti PARP10 pAb (ATL-HPA052427) |