Anti PARP1 pAb (ATL-HPA045168 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045168-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PARP1
Alternative Gene Name: ADPRT, PARP, PPOL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026496: 95%, ENSRNOG00000003084: 94%
Entrez Gene ID: 142
Uniprot ID: P09874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM |
| Gene Sequence | KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM |
| Gene ID - Mouse | ENSMUSG00000026496 |
| Gene ID - Rat | ENSRNOG00000003084 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PARP1 pAb (ATL-HPA045168 w/enhanced validation) | |
| Datasheet | Anti PARP1 pAb (ATL-HPA045168 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PARP1 pAb (ATL-HPA045168 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PARP1 pAb (ATL-HPA045168 w/enhanced validation) | |
| Datasheet | Anti PARP1 pAb (ATL-HPA045168 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PARP1 pAb (ATL-HPA045168 w/enhanced validation) |
| Citations for Anti PARP1 pAb (ATL-HPA045168 w/enhanced validation) – 7 Found |
| Wang, Qi; Zhao, Tong; Zhang, Wei; Yu, Wenbin; Liu, Bin; Wang, Zhaoyang; Qiao, Wen; Lu, Qinghua; Wang, Aihua; Zhang, Mingxiang. Poly (ADP-Ribose) Polymerase 1 Mediated Arginase II Activation Is Responsible for Oxidized LDL-Induced Endothelial Dysfunction. Frontiers In Pharmacology. 9( 30158868):882. PubMed |
| Yu, Chia-Cheng; Li, Chien-Feng; Chen, I-Hsuan; Lai, Ming-Tsung; Lin, Zi-Jun; Korla, Praveen K; Chai, Chee-Yin; Ko, Grace; Chen, Chih-Mei; Hwang, Tritium; Lee, Shan-Chih; Sheu, Jim J-C. YWHAZ amplification/overexpression defines aggressive bladder cancer and contributes to chemo-/radio-resistance by suppressing caspase-mediated apoptosis. The Journal Of Pathology. 2019;248(4):476-487. PubMed |
| Guibbal, Florian; Hopkins, Samantha L; Pacelli, Anna; Isenegger, Patrick G; Mosley, Michael; Torres, Julia Baguña; Dias, Gemma M; Mahaut, Damien; Hueting, Rebekka; Gouverneur, Véronique; Cornelissen, Bart. [(18)F]AZD2461, an Insight on Difference in PARP Binding Profiles for DNA Damage Response PET Imaging. Molecular Imaging And Biology. 2020;22(5):1226-1234. PubMed |
| Sun, Yunguang; Yang, Ning; Utama, Fransiscus E; Udhane, Sameer S; Zhang, Junling; Peck, Amy R; Yanac, Alicia; Duffey, Katherine; Langenheim, John F; Udhane, Vindhya; Xia, Guanjun; Peterson, Jess F; Jorns, Julie M; Nevalainen, Marja T; Rouet, Romain; Schofield, Peter; Christ, Daniel; Ormandy, Christopher J; Rosenberg, Anne L; Chervoneva, Inna; Tsaih, Shirng-Wern; Flister, Michael J; Fuchs, Serge Y; Wagner, Kay-Uwe; Rui, Hallgeir. NSG-Pro mouse model for uncovering resistance mechanisms and unique vulnerabilities in human luminal breast cancers. Science Advances. 2021;7(38):eabc8145. PubMed |
| Chan, Chung Ying; Hopkins, Samantha L; Guibbal, Florian; Pacelli, Anna; Baguña Torres, Julia; Mosley, Michael; Lau, Doreen; Isenegger, Patrick; Chen, Zijun; Wilson, Thomas C; Dias, Gemma; Hueting, Rebekka; Gouverneur, Véronique; Cornelissen, Bart. Correlation between molar activity, injection mass and uptake of the PARP targeting radiotracer [(18)F]olaparib in mouse models of glioma. Ejnmmi Research. 2022;12(1):67. PubMed |
| Estève, Pierre-Olivier; Sen, Sagnik; Vishnu, Udayakumar S; Ruse, Cristian; Chin, Hang Gyeong; Pradhan, Sriharsa. Poly ADP-ribosylation of SET8 leads to aberrant H4K20 methylation in mammalian nuclear genome. Communications Biology. 2022;5(1):1292. PubMed |
| Molitor, Lena; Klostermann, Melina; Bacher, Sabrina; Merl-Pham, Juliane; Spranger, Nadine; Burczyk, Sandra; Ketteler, Carolin; Rusha, Ejona; Tews, Daniel; Pertek, Anna; Proske, Marcel; Busch, Anke; Reschke, Sarah; Feederle, Regina; Hauck, Stefanie M; Blum, Helmut; Drukker, Micha; Fischer-Posovszky, Pamela; König, Julian; Zarnack, Kathi; Niessing, Dierk. Depletion of the RNA-binding protein PURA triggers changes in posttranscriptional gene regulation and loss of P-bodies. Nucleic Acids Research. 2023;51(3):1297-1316. PubMed |