Anti PARG pAb (ATL-HPA053007)

Atlas Antibodies

Catalog No.:
ATL-HPA053007-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: poly (ADP-ribose) glycohydrolase
Gene Name: PARG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021911: 84%, ENSRNOG00000019978: 84%
Entrez Gene ID: 8505
Uniprot ID: Q86W56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT
Gene Sequence ERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT
Gene ID - Mouse ENSMUSG00000021911
Gene ID - Rat ENSRNOG00000019978
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PARG pAb (ATL-HPA053007)
Datasheet Anti PARG pAb (ATL-HPA053007) Datasheet (External Link)
Vendor Page Anti PARG pAb (ATL-HPA053007) at Atlas Antibodies

Documents & Links for Anti PARG pAb (ATL-HPA053007)
Datasheet Anti PARG pAb (ATL-HPA053007) Datasheet (External Link)
Vendor Page Anti PARG pAb (ATL-HPA053007)