Anti PARG pAb (ATL-HPA053007)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053007-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PARG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021911: 84%, ENSRNOG00000019978: 84%
Entrez Gene ID: 8505
Uniprot ID: Q86W56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT |
Gene Sequence | ERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT |
Gene ID - Mouse | ENSMUSG00000021911 |
Gene ID - Rat | ENSRNOG00000019978 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PARG pAb (ATL-HPA053007) | |
Datasheet | Anti PARG pAb (ATL-HPA053007) Datasheet (External Link) |
Vendor Page | Anti PARG pAb (ATL-HPA053007) at Atlas Antibodies |
Documents & Links for Anti PARG pAb (ATL-HPA053007) | |
Datasheet | Anti PARG pAb (ATL-HPA053007) Datasheet (External Link) |
Vendor Page | Anti PARG pAb (ATL-HPA053007) |