Anti PAQR8 pAb (ATL-HPA064625)

Atlas Antibodies

SKU:
ATL-HPA064625-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: progestin and adipoQ receptor family member VIII
Gene Name: PAQR8
Alternative Gene Name: C6orf33, LMPB1, MPRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025931: 96%, ENSRNOG00000012830: 98%
Entrez Gene ID: 85315
Uniprot ID: Q8TEZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY
Gene Sequence MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY
Gene ID - Mouse ENSMUSG00000025931
Gene ID - Rat ENSRNOG00000012830
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PAQR8 pAb (ATL-HPA064625)
Datasheet Anti PAQR8 pAb (ATL-HPA064625) Datasheet (External Link)
Vendor Page Anti PAQR8 pAb (ATL-HPA064625) at Atlas Antibodies

Documents & Links for Anti PAQR8 pAb (ATL-HPA064625)
Datasheet Anti PAQR8 pAb (ATL-HPA064625) Datasheet (External Link)
Vendor Page Anti PAQR8 pAb (ATL-HPA064625)