Anti PAQR8 pAb (ATL-HPA064625)

Atlas Antibodies

Catalog No.: ATL-HPA064625-25

Protein Description: progestin and adipoQ receptor family member VIII
Gene Name: PAQR8
Alternative Gene Name: C6orf33, LMPB1, MPRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025931: 96%, ENSRNOG00000012830: 98%
Entrez Gene ID: 85315
Uniprot ID: Q8TEZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY
• Gene Sequence: MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY
• Gene ID - Mouse: ENSMUSG00000025931
• Gene ID - Rat: ENSRNOG00000012830
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.