Anti PAPSS2 pAb (ATL-HPA071224)

Atlas Antibodies

Catalog No.:
ATL-HPA071224-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Gene Name: PAPSS2
Alternative Gene Name: ATPSK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024899: 85%, ENSRNOG00000011068: 81%
Entrez Gene ID: 9060
Uniprot ID: O95340
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQV
Gene Sequence VVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQV
Gene ID - Mouse ENSMUSG00000024899
Gene ID - Rat ENSRNOG00000011068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAPSS2 pAb (ATL-HPA071224)
Datasheet Anti PAPSS2 pAb (ATL-HPA071224) Datasheet (External Link)
Vendor Page Anti PAPSS2 pAb (ATL-HPA071224) at Atlas Antibodies

Documents & Links for Anti PAPSS2 pAb (ATL-HPA071224)
Datasheet Anti PAPSS2 pAb (ATL-HPA071224) Datasheet (External Link)
Vendor Page Anti PAPSS2 pAb (ATL-HPA071224)