Anti PAPSS1 pAb (ATL-HPA049781)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049781-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PAPSS1
Alternative Gene Name: ATPSK1, PAPSS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028032: 98%, ENSRNOG00000011311: 98%
Entrez Gene ID: 9061
Uniprot ID: O43252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE |
Gene Sequence | QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE |
Gene ID - Mouse | ENSMUSG00000028032 |
Gene ID - Rat | ENSRNOG00000011311 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PAPSS1 pAb (ATL-HPA049781) | |
Datasheet | Anti PAPSS1 pAb (ATL-HPA049781) Datasheet (External Link) |
Vendor Page | Anti PAPSS1 pAb (ATL-HPA049781) at Atlas Antibodies |
Documents & Links for Anti PAPSS1 pAb (ATL-HPA049781) | |
Datasheet | Anti PAPSS1 pAb (ATL-HPA049781) Datasheet (External Link) |
Vendor Page | Anti PAPSS1 pAb (ATL-HPA049781) |