Anti PAPSS1 pAb (ATL-HPA049781)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049781-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PAPSS1
Alternative Gene Name: ATPSK1, PAPSS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028032: 98%, ENSRNOG00000011311: 98%
Entrez Gene ID: 9061
Uniprot ID: O43252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE |
| Gene Sequence | QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAE |
| Gene ID - Mouse | ENSMUSG00000028032 |
| Gene ID - Rat | ENSRNOG00000011311 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAPSS1 pAb (ATL-HPA049781) | |
| Datasheet | Anti PAPSS1 pAb (ATL-HPA049781) Datasheet (External Link) |
| Vendor Page | Anti PAPSS1 pAb (ATL-HPA049781) at Atlas Antibodies |
| Documents & Links for Anti PAPSS1 pAb (ATL-HPA049781) | |
| Datasheet | Anti PAPSS1 pAb (ATL-HPA049781) Datasheet (External Link) |
| Vendor Page | Anti PAPSS1 pAb (ATL-HPA049781) |