Anti PAPPA2 pAb (ATL-HPA018430 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018430-25

Protein Description: pappalysin 2
Gene Name: PAPPA2
Alternative Gene Name: PAPP-A2, PAPPE, PLAC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073530: 67%, ENSRNOG00000042860: 64%
Entrez Gene ID: 60676
Uniprot ID: Q9BXP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDSSEDGHYFRGHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVLQGFE
• Gene Sequence: GDSSEDGHYFRGHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVLQGFE
• Gene ID - Mouse: ENSMUSG00000073530
• Gene ID - Rat: ENSRNOG00000042860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PAPPA2 pAb (ATL-HPA018430 w/enhanced validation) – 2 Found

Chiu, Nan-Fu; Tai, Ming-Jung; Wu, Hwai-Ping; Lin, Ting-Li; Chen, Chen-Yu. Development of a bioaffinity SPR immunosensor based on functionalized graphene oxide for the detection of pregnancy-associated plasma protein A2 in human plasma. International Journal Of Nanomedicine. 14( 31686806):6735-6748. 

Fan, Shi-Yuan; Chiu, Nan-Fu; Chen, Chie-Pein; Chang, Chia-Chen; Chen, Chen-Yu. Simultaneous Real-Time Detection of Pregnancy-Associated Plasma Protein-A and -A2 Using a Graphene Oxide-Based Surface Plasmon Resonance Biosensor. International Journal Of Nanomedicine. 15( 32273704):2085-2094.