Anti PAPD4 pAb (ATL-HPA054468)

Atlas Antibodies

Catalog No.:
ATL-HPA054468-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: PAP associated domain containing 4
Gene Name: PAPD4
Alternative Gene Name: FLJ38499, GLD2, TUT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042167: 89%, ENSRNOG00000012099: 89%
Entrez Gene ID: 167153
Uniprot ID: Q6PIY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRT
Gene Sequence HSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRT
Gene ID - Mouse ENSMUSG00000042167
Gene ID - Rat ENSRNOG00000012099
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAPD4 pAb (ATL-HPA054468)
Datasheet Anti PAPD4 pAb (ATL-HPA054468) Datasheet (External Link)
Vendor Page Anti PAPD4 pAb (ATL-HPA054468) at Atlas Antibodies

Documents & Links for Anti PAPD4 pAb (ATL-HPA054468)
Datasheet Anti PAPD4 pAb (ATL-HPA054468) Datasheet (External Link)
Vendor Page Anti PAPD4 pAb (ATL-HPA054468)