Anti PAPD4 pAb (ATL-HPA054468)

Atlas Antibodies

Catalog No.: ATL-HPA054468-100

Protein Description: PAP associated domain containing 4
Gene Name: PAPD4
Alternative Gene Name: FLJ38499, GLD2, TUT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042167: 89%, ENSRNOG00000012099: 89%
Entrez Gene ID: 167153
Uniprot ID: Q6PIY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRT
• Gene Sequence: HSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRT
• Gene ID - Mouse: ENSMUSG00000042167
• Gene ID - Rat: ENSRNOG00000012099
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.