Anti PAPD4 pAb (ATL-HPA054468)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054468-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: PAPD4
Alternative Gene Name: FLJ38499, GLD2, TUT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042167: 89%, ENSRNOG00000012099: 89%
Entrez Gene ID: 167153
Uniprot ID: Q6PIY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRT |
| Gene Sequence | HSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRT |
| Gene ID - Mouse | ENSMUSG00000042167 |
| Gene ID - Rat | ENSRNOG00000012099 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAPD4 pAb (ATL-HPA054468) | |
| Datasheet | Anti PAPD4 pAb (ATL-HPA054468) Datasheet (External Link) |
| Vendor Page | Anti PAPD4 pAb (ATL-HPA054468) at Atlas Antibodies |
| Documents & Links for Anti PAPD4 pAb (ATL-HPA054468) | |
| Datasheet | Anti PAPD4 pAb (ATL-HPA054468) Datasheet (External Link) |
| Vendor Page | Anti PAPD4 pAb (ATL-HPA054468) |