Anti PAM16 pAb (ATL-HPA062721)

Atlas Antibodies

SKU: ATL-HPA062721-25

• 

Protein Description: presequence translocase-associated motor 16 homolog (S. cerevisiae)
Gene Name: PAM16
Alternative Gene Name: Magmas, Tim16, TIMM16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045886: 94%, ENSRNOG00000004608: 94%
Entrez Gene ID: 51025
Uniprot ID: Q9Y3D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
• Gene Sequence: VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
• Gene ID - Mouse: ENSMUSG00000045886
• Gene ID - Rat: ENSRNOG00000004608
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.