Anti PALM3 pAb (ATL-HPA056119)

Atlas Antibodies

Catalog No.:
ATL-HPA056119-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: paralemmin 3
Gene Name: PALM3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014776: 35%, ENSRNOG00000015588: 36%
Entrez Gene ID: 342979
Uniprot ID: A6NDB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EATKEPLEAERKGGEETLEAEKRGGEESLETEKTQGTEGDLNLEQGSREGSESQAEEMNEAGPPLEANTETRPEKEGPQPQEKPVGA
Gene Sequence EATKEPLEAERKGGEETLEAEKRGGEESLETEKTQGTEGDLNLEQGSREGSESQAEEMNEAGPPLEANTETRPEKEGPQPQEKPVGA
Gene ID - Mouse ENSMUSG00000014776
Gene ID - Rat ENSRNOG00000015588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PALM3 pAb (ATL-HPA056119)
Datasheet Anti PALM3 pAb (ATL-HPA056119) Datasheet (External Link)
Vendor Page Anti PALM3 pAb (ATL-HPA056119) at Atlas Antibodies

Documents & Links for Anti PALM3 pAb (ATL-HPA056119)
Datasheet Anti PALM3 pAb (ATL-HPA056119) Datasheet (External Link)
Vendor Page Anti PALM3 pAb (ATL-HPA056119)