Anti PALM2 pAb (ATL-HPA074153)

Atlas Antibodies

Catalog No.:
ATL-HPA074153-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: paralemmin 2
Gene Name: PALM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090053: 87%, ENSRNOG00000025558: 87%
Entrez Gene ID: 114299
Uniprot ID: Q8IXS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQ
Gene Sequence TKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQ
Gene ID - Mouse ENSMUSG00000090053
Gene ID - Rat ENSRNOG00000025558
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PALM2 pAb (ATL-HPA074153)
Datasheet Anti PALM2 pAb (ATL-HPA074153) Datasheet (External Link)
Vendor Page Anti PALM2 pAb (ATL-HPA074153) at Atlas Antibodies

Documents & Links for Anti PALM2 pAb (ATL-HPA074153)
Datasheet Anti PALM2 pAb (ATL-HPA074153) Datasheet (External Link)
Vendor Page Anti PALM2 pAb (ATL-HPA074153)