Anti PALD1 pAb (ATL-HPA017343)

Atlas Antibodies

Catalog No.: ATL-HPA017343-25

Protein Description: phosphatase domain containing, paladin 1
Gene Name: PALD1
Alternative Gene Name: KIAA1274, PALD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020092: 88%, ENSRNOG00000000561: 89%
Entrez Gene ID: 27143
Uniprot ID: Q9ULE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEFQVVMKVVQLLPDGHRVKKEVDAALDTVSETMTPMHYHLREIIICTYRQAKAAKEAQEMRRLQLRSLQYLERYVCLILFNAYLHLEKADSWQRPFSTWMQ
• Gene Sequence: GEFQVVMKVVQLLPDGHRVKKEVDAALDTVSETMTPMHYHLREIIICTYRQAKAAKEAQEMRRLQLRSLQYLERYVCLILFNAYLHLEKADSWQRPFSTWMQ
• Gene ID - Mouse: ENSMUSG00000020092
• Gene ID - Rat: ENSRNOG00000000561
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PALD1 pAb (ATL-HPA017343) – 3 Found

Egaña, Isabel; Kaito, Hiroshi; Nitzsche, Anja; Becker, Lore; Ballester-Lopez, Carolina; Niaudet, Colin; Petkova, Milena; Liu, Wei; Vanlandewijck, Michael; Vernaleken, Alexandra; Klopstock, Thomas; Fuchs, Helmut; Gailus-Durner, Valerie; Hrabe de Angelis, Martin; Rask-Andersen, Helge; Johansson, Henrik J; Lehtiö, Janne; He, Liqun; Yildirim, Ali Ö; Hellström, Mats. Female mice lacking Pald1 exhibit endothelial cell apoptosis and emphysema. Scientific Reports. 2017;7(1):15453. 

Wallgard, Elisabet; Nitzsche, Anja; Larsson, Jimmy; Guo, Xiaoyuan; Dieterich, Lothar C; Dimberg, Anna; Olofsson, Tommie; Pontén, Fredrik C; Mäkinen, Taija; Kalén, Mattias; Hellström, Mats. Paladin (X99384) is expressed in the vasculature and shifts from endothelial to vascular smooth muscle cells during mouse development. Developmental Dynamics : An Official Publication Of The American Association Of Anatomists. 2012;241(4):770-86. 

Nitzsche, Anja; Pietilä, Riikka; Love, Dominic T; Testini, Chiara; Ninchoji, Takeshi; Smith, Ross O; Ekvärn, Elisabet; Larsson, Jimmy; Roche, Francis P; Egaña, Isabel; Jauhiainen, Suvi; Berger, Philipp; Claesson-Welsh, Lena; Hellström, Mats. Paladin is a phosphoinositide phosphatase regulating endosomal VEGFR2 signalling and angiogenesis. Embo Reports. 2021;22(2):e50218.