Anti PALB2 pAb (ATL-HPA057000)

Atlas Antibodies

Catalog No.:
ATL-HPA057000-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: partner and localizer of BRCA2
Gene Name: PALB2
Alternative Gene Name: FANCN, FLJ21816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044702: 39%, ENSRNOG00000025126: 41%
Entrez Gene ID: 79728
Uniprot ID: Q86YC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSL
Gene Sequence YDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSL
Gene ID - Mouse ENSMUSG00000044702
Gene ID - Rat ENSRNOG00000025126
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PALB2 pAb (ATL-HPA057000)
Datasheet Anti PALB2 pAb (ATL-HPA057000) Datasheet (External Link)
Vendor Page Anti PALB2 pAb (ATL-HPA057000) at Atlas Antibodies

Documents & Links for Anti PALB2 pAb (ATL-HPA057000)
Datasheet Anti PALB2 pAb (ATL-HPA057000) Datasheet (External Link)
Vendor Page Anti PALB2 pAb (ATL-HPA057000)