Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA070175-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: p21 protein (Cdc42/Rac)-activated kinase 4
Gene Name: PAK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030602: 98%, ENSRNOG00000019883: 98%
Entrez Gene ID: 10298
Uniprot ID: O96013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQWQSLIEESARRPKPLVDPACITSIQPGAPKTIVRGSKGAKDGALTLLLDEFENM
Gene Sequence RQWQSLIEESARRPKPLVDPACITSIQPGAPKTIVRGSKGAKDGALTLLLDEFENM
Gene ID - Mouse ENSMUSG00000030602
Gene ID - Rat ENSRNOG00000019883
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation)
Datasheet Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation)
Datasheet Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation)