Anti PAIP2B pAb (ATL-HPA072371)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072371-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PAIP2B
Alternative Gene Name: KIAA1155
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045896: 80%, ENSRNOG00000014092: 80%
Entrez Gene ID: 400961
Uniprot ID: Q9ULR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSDLNPDA |
| Gene Sequence | IPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSDLNPDA |
| Gene ID - Mouse | ENSMUSG00000045896 |
| Gene ID - Rat | ENSRNOG00000014092 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAIP2B pAb (ATL-HPA072371) | |
| Datasheet | Anti PAIP2B pAb (ATL-HPA072371) Datasheet (External Link) |
| Vendor Page | Anti PAIP2B pAb (ATL-HPA072371) at Atlas Antibodies |
| Documents & Links for Anti PAIP2B pAb (ATL-HPA072371) | |
| Datasheet | Anti PAIP2B pAb (ATL-HPA072371) Datasheet (External Link) |
| Vendor Page | Anti PAIP2B pAb (ATL-HPA072371) |