Anti PAIP2 pAb (ATL-HPA056766)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056766-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PAIP2
Alternative Gene Name: PAIP2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037058: 94%, ENSRNOG00000048424: 94%
Entrez Gene ID: 51247
Uniprot ID: Q9BPZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYM |
Gene Sequence | KDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYM |
Gene ID - Mouse | ENSMUSG00000037058 |
Gene ID - Rat | ENSRNOG00000048424 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PAIP2 pAb (ATL-HPA056766) | |
Datasheet | Anti PAIP2 pAb (ATL-HPA056766) Datasheet (External Link) |
Vendor Page | Anti PAIP2 pAb (ATL-HPA056766) at Atlas Antibodies |
Documents & Links for Anti PAIP2 pAb (ATL-HPA056766) | |
Datasheet | Anti PAIP2 pAb (ATL-HPA056766) Datasheet (External Link) |
Vendor Page | Anti PAIP2 pAb (ATL-HPA056766) |