Anti PAIP1 pAb (ATL-HPA073653)

Atlas Antibodies

Catalog No.:
ATL-HPA073653-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: poly(A) binding protein interacting protein 1
Gene Name: PAIP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025451: 98%, ENSRNOG00000058580: 98%
Entrez Gene ID: 10605
Uniprot ID: Q9H074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK
Gene Sequence GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK
Gene ID - Mouse ENSMUSG00000025451
Gene ID - Rat ENSRNOG00000058580
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAIP1 pAb (ATL-HPA073653)
Datasheet Anti PAIP1 pAb (ATL-HPA073653) Datasheet (External Link)
Vendor Page Anti PAIP1 pAb (ATL-HPA073653) at Atlas Antibodies

Documents & Links for Anti PAIP1 pAb (ATL-HPA073653)
Datasheet Anti PAIP1 pAb (ATL-HPA073653) Datasheet (External Link)
Vendor Page Anti PAIP1 pAb (ATL-HPA073653)