Anti PAICS pAb (ATL-HPA035895 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035895-100

Protein Description: phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Gene Name: PAICS
Alternative Gene Name: ADE2H1, AIRC, PAIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029247: 96%, ENSRNOG00000056398: 96%
Entrez Gene ID: 10606
Uniprot ID: P22234
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS
• Gene Sequence: ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS
• Gene ID - Mouse: ENSMUSG00000029247
• Gene ID - Rat: ENSRNOG00000056398
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PAICS pAb (ATL-HPA035895 w/enhanced validation) – 3 Found

Duval, Nathan; Luhrs, Kyleen; Wilkinson, Terry G 2nd; Baresova, Veronika; Skopova, Vaclava; Kmoch, Stanislav; Vacano, Guido N; Zikanova, Marie; Patterson, David. Genetic and metabolomic analysis of AdeD and AdeI mutants of de novo purine biosynthesis: cellular models of de novo purine biosynthesis deficiency disorders. Molecular Genetics And Metabolism. 2013;108(3):178-189. 

Zhao, Alice; Tsechansky, Mark; Swaminathan, Jagannath; Cook, Lindsey; Ellington, Andrew D; Marcotte, Edward M. Transiently transfected purine biosynthetic enzymes form stress bodies. Plos One. 8(2):e56203. 

Barfeld, Stefan J; Fazli, Ladan; Persson, Margareta; Marjavaara, Lisette; Urbanucci, Alfonso; Kaukoniemi, Kirsi M; Rennie, Paul S; Ceder, Yvonne; Chabes, Andrei; Visakorpi, Tapio; Mills, Ian G. Myc-dependent purine biosynthesis affects nucleolar stress and therapy response in prostate cancer. Oncotarget. 2015;6(14):12587-602.