Anti PAGE3 pAb (ATL-HPA062248)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062248-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PAGE3
Alternative Gene Name: CT16.6, GAGED1, PAGE-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074129: 38%, ENSRNOG00000061182: 41%
Entrez Gene ID: 139793
Uniprot ID: Q5JUK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV |
| Gene Sequence | GERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV |
| Gene ID - Mouse | ENSMUSG00000074129 |
| Gene ID - Rat | ENSRNOG00000061182 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAGE3 pAb (ATL-HPA062248) | |
| Datasheet | Anti PAGE3 pAb (ATL-HPA062248) Datasheet (External Link) |
| Vendor Page | Anti PAGE3 pAb (ATL-HPA062248) at Atlas Antibodies |
| Documents & Links for Anti PAGE3 pAb (ATL-HPA062248) | |
| Datasheet | Anti PAGE3 pAb (ATL-HPA062248) Datasheet (External Link) |
| Vendor Page | Anti PAGE3 pAb (ATL-HPA062248) |