Anti PAGE3 pAb (ATL-HPA062248)
Atlas Antibodies
- SKU:
- ATL-HPA062248-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PAGE3
Alternative Gene Name: CT16.6, GAGED1, PAGE-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074129: 38%, ENSRNOG00000061182: 41%
Entrez Gene ID: 139793
Uniprot ID: Q5JUK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV |
Gene Sequence | GERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV |
Gene ID - Mouse | ENSMUSG00000074129 |
Gene ID - Rat | ENSRNOG00000061182 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PAGE3 pAb (ATL-HPA062248) | |
Datasheet | Anti PAGE3 pAb (ATL-HPA062248) Datasheet (External Link) |
Vendor Page | Anti PAGE3 pAb (ATL-HPA062248) at Atlas Antibodies |
Documents & Links for Anti PAGE3 pAb (ATL-HPA062248) | |
Datasheet | Anti PAGE3 pAb (ATL-HPA062248) Datasheet (External Link) |
Vendor Page | Anti PAGE3 pAb (ATL-HPA062248) |