Anti PAGE2B pAb (ATL-HPA052619)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052619-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PAGE2B
Alternative Gene Name: CT16.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024347: 37%, ENSRNOG00000019177: 35%
Entrez Gene ID: 389860
Uniprot ID: Q5JRK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QGIAPSGEIENEGAPAVQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDA |
Gene Sequence | QGIAPSGEIENEGAPAVQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDA |
Gene ID - Mouse | ENSMUSG00000024347 |
Gene ID - Rat | ENSRNOG00000019177 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PAGE2B pAb (ATL-HPA052619) | |
Datasheet | Anti PAGE2B pAb (ATL-HPA052619) Datasheet (External Link) |
Vendor Page | Anti PAGE2B pAb (ATL-HPA052619) at Atlas Antibodies |
Documents & Links for Anti PAGE2B pAb (ATL-HPA052619) | |
Datasheet | Anti PAGE2B pAb (ATL-HPA052619) Datasheet (External Link) |
Vendor Page | Anti PAGE2B pAb (ATL-HPA052619) |
Citations for Anti PAGE2B pAb (ATL-HPA052619) – 2 Found |
Djureinovic, Dijana; Hallström, Björn M; Horie, Masafumi; Mattsson, Johanna Sofia Margareta; La Fleur, Linnea; Fagerberg, Linn; Brunnström, Hans; Lindskog, Cecilia; Madjar, Katrin; Rahnenführer, Jörg; Ekman, Simon; Ståhle, Elisabeth; Koyi, Hirsh; Brandén, Eva; Edlund, Karolina; Hengstler, Jan G; Lambe, Mats; Saito, Akira; Botling, Johan; Pontén, Fredrik; Uhlén, Mathias; Micke, Patrick. Profiling cancer testis antigens in non-small-cell lung cancer. Jci Insight. 2016;1(10):e86837. PubMed |
Zandian, A; Wingård, L; Nilsson, H; Sjöstedt, E; Johansson, D X; Just, D; Hellström, C; Uhlén, M; Schwenk, J M; Häggmark-Månberg, A; Norbeck, O; Owe-Larsson, B; Nilsson, P; Persson, M A A. Untargeted screening for novel autoantibodies with prognostic value in first-episode psychosis. Translational Psychiatry. 2017;7(7):e1177. PubMed |