Anti PAGE2B pAb (ATL-HPA052619)

Atlas Antibodies

Catalog No.:
ATL-HPA052619-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: P antigen family, member 2B
Gene Name: PAGE2B
Alternative Gene Name: CT16.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024347: 37%, ENSRNOG00000019177: 35%
Entrez Gene ID: 389860
Uniprot ID: Q5JRK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGIAPSGEIENEGAPAVQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDA
Gene Sequence QGIAPSGEIENEGAPAVQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDA
Gene ID - Mouse ENSMUSG00000024347
Gene ID - Rat ENSRNOG00000019177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAGE2B pAb (ATL-HPA052619)
Datasheet Anti PAGE2B pAb (ATL-HPA052619) Datasheet (External Link)
Vendor Page Anti PAGE2B pAb (ATL-HPA052619) at Atlas Antibodies

Documents & Links for Anti PAGE2B pAb (ATL-HPA052619)
Datasheet Anti PAGE2B pAb (ATL-HPA052619) Datasheet (External Link)
Vendor Page Anti PAGE2B pAb (ATL-HPA052619)
Citations for Anti PAGE2B pAb (ATL-HPA052619) – 2 Found
Djureinovic, Dijana; Hallström, Björn M; Horie, Masafumi; Mattsson, Johanna Sofia Margareta; La Fleur, Linnea; Fagerberg, Linn; Brunnström, Hans; Lindskog, Cecilia; Madjar, Katrin; Rahnenführer, Jörg; Ekman, Simon; Ståhle, Elisabeth; Koyi, Hirsh; Brandén, Eva; Edlund, Karolina; Hengstler, Jan G; Lambe, Mats; Saito, Akira; Botling, Johan; Pontén, Fredrik; Uhlén, Mathias; Micke, Patrick. Profiling cancer testis antigens in non-small-cell lung cancer. Jci Insight. 2016;1(10):e86837.  PubMed
Zandian, A; Wingård, L; Nilsson, H; Sjöstedt, E; Johansson, D X; Just, D; Hellström, C; Uhlén, M; Schwenk, J M; Häggmark-Månberg, A; Norbeck, O; Owe-Larsson, B; Nilsson, P; Persson, M A A. Untargeted screening for novel autoantibodies with prognostic value in first-episode psychosis. Translational Psychiatry. 2017;7(7):e1177.  PubMed