Anti PAFAH2 pAb (ATL-HPA018157)

Atlas Antibodies

Catalog No.: ATL-HPA018157-25

Protein Description: platelet-activating factor acetylhydrolase 2, 40kDa
Gene Name: PAFAH2
Alternative Gene Name: HSD-PLA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037366: 74%, ENSRNOG00000022288: 76%
Entrez Gene ID: 5051
Uniprot ID: Q99487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHS
• Gene Sequence: RGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHS
• Gene ID - Mouse: ENSMUSG00000037366
• Gene ID - Rat: ENSRNOG00000022288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.