Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA062294-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: peptidyl arginine deiminase, type I
Gene Name: PADI1
Alternative Gene Name: HPAD10, PAD1, PDI, PDI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025329: 82%, ENSRNOG00000007067: 82%
Entrez Gene ID: 29943
Uniprot ID: Q9ULC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN
Gene Sequence PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN
Gene ID - Mouse ENSMUSG00000025329
Gene ID - Rat ENSRNOG00000007067
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation)
Datasheet Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation)
Datasheet Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation)
Citations for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) – 1 Found
Casanova, Víctor; Sousa, Filipa Henderson; Shakamuri, Priyanka; Svoboda, Pavel; Buch, Chloé; D'Acremont, Mathilde; Christophorou, Maria A; Pohl, Jan; Stevens, Craig; Barlow, Peter G. Citrullination Alters the Antiviral and Immunomodulatory Activities of the Human Cathelicidin LL-37 During Rhinovirus Infection. Frontiers In Immunology. 11( 32117246):85.  PubMed