Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062294-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PADI1
Alternative Gene Name: HPAD10, PAD1, PDI, PDI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025329: 82%, ENSRNOG00000007067: 82%
Entrez Gene ID: 29943
Uniprot ID: Q9ULC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN |
Gene Sequence | PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN |
Gene ID - Mouse | ENSMUSG00000025329 |
Gene ID - Rat | ENSRNOG00000007067 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) | |
Datasheet | Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) | |
Datasheet | Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) |
Citations for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) – 1 Found |
Casanova, Víctor; Sousa, Filipa Henderson; Shakamuri, Priyanka; Svoboda, Pavel; Buch, Chloé; D'Acremont, Mathilde; Christophorou, Maria A; Pohl, Jan; Stevens, Craig; Barlow, Peter G. Citrullination Alters the Antiviral and Immunomodulatory Activities of the Human Cathelicidin LL-37 During Rhinovirus Infection. Frontiers In Immunology. 11( 32117246):85. PubMed |