Anti PACSIN2 pAb (ATL-HPA056520 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056520-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: protein kinase C and casein kinase substrate in neurons 2
Gene Name: PACSIN2
Alternative Gene Name: SDPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016664: 90%, ENSRNOG00000009756: 90%
Entrez Gene ID: 11252
Uniprot ID: Q9UNF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLR
Gene Sequence FEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLR
Gene ID - Mouse ENSMUSG00000016664
Gene ID - Rat ENSRNOG00000009756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PACSIN2 pAb (ATL-HPA056520 w/enhanced validation)
Datasheet Anti PACSIN2 pAb (ATL-HPA056520 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PACSIN2 pAb (ATL-HPA056520 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PACSIN2 pAb (ATL-HPA056520 w/enhanced validation)
Datasheet Anti PACSIN2 pAb (ATL-HPA056520 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PACSIN2 pAb (ATL-HPA056520 w/enhanced validation)