Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049854-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: PACSIN2
Alternative Gene Name: SDPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016664: 85%, ENSRNOG00000009756: 85%
Entrez Gene ID: 11252
Uniprot ID: Q9UNF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS |
Gene Sequence | NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS |
Gene ID - Mouse | ENSMUSG00000016664 |
Gene ID - Rat | ENSRNOG00000009756 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation) | |
Datasheet | Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation) | |
Datasheet | Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation) |
Citations for Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation) – 3 Found |
Grega-Larson, Nathan E; Crawley, Scott W; Erwin, Amanda L; Tyska, Matthew J. Cordon bleu promotes the assembly of brush border microvilli. Molecular Biology Of The Cell. 2015;26(21):3803-15. PubMed |
Feng, Qiang; Bonder, Edward M; Engevik, Amy C; Zhang, Lanjing; Tyska, Matthew J; Goldenring, James R; Gao, Nan. Disruption of Rab8a and Rab11a causes formation of basolateral microvilli in neonatal enteropathy. Journal Of Cell Science. 2017;130(15):2491-2505. PubMed |
Postema, Meagan M; Grega-Larson, Nathan E; Meenderink, Leslie M; Tyska, Matthew J. PACSIN2-dependent apical endocytosis regulates the morphology of epithelial microvilli. Molecular Biology Of The Cell. 2019;30(19):2515-2526. PubMed |