Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049854-100

• 
• 

Protein Description: protein kinase C and casein kinase substrate in neurons 2
Gene Name: PACSIN2
Alternative Gene Name: SDPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016664: 85%, ENSRNOG00000009756: 85%
Entrez Gene ID: 11252
Uniprot ID: Q9UNF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS
• Gene Sequence: NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS
• Gene ID - Mouse: ENSMUSG00000016664
• Gene ID - Rat: ENSRNOG00000009756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PACSIN2 pAb (ATL-HPA049854 w/enhanced validation) – 3 Found

Grega-Larson, Nathan E; Crawley, Scott W; Erwin, Amanda L; Tyska, Matthew J. Cordon bleu promotes the assembly of brush border microvilli. Molecular Biology Of The Cell. 2015;26(21):3803-15. 

Feng, Qiang; Bonder, Edward M; Engevik, Amy C; Zhang, Lanjing; Tyska, Matthew J; Goldenring, James R; Gao, Nan. Disruption of Rab8a and Rab11a causes formation of basolateral microvilli in neonatal enteropathy. Journal Of Cell Science. 2017;130(15):2491-2505. 

Postema, Meagan M; Grega-Larson, Nathan E; Meenderink, Leslie M; Tyska, Matthew J. PACSIN2-dependent apical endocytosis regulates the morphology of epithelial microvilli. Molecular Biology Of The Cell. 2019;30(19):2515-2526.