Anti PACRGL pAb (ATL-HPA054666)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054666-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PACRGL
Alternative Gene Name: C4orf28, MGC29898
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029089: 80%, ENSRNOG00000004140: 77%
Entrez Gene ID: 133015
Uniprot ID: Q8N7B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIP |
Gene Sequence | LLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIP |
Gene ID - Mouse | ENSMUSG00000029089 |
Gene ID - Rat | ENSRNOG00000004140 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PACRGL pAb (ATL-HPA054666) | |
Datasheet | Anti PACRGL pAb (ATL-HPA054666) Datasheet (External Link) |
Vendor Page | Anti PACRGL pAb (ATL-HPA054666) at Atlas Antibodies |
Documents & Links for Anti PACRGL pAb (ATL-HPA054666) | |
Datasheet | Anti PACRGL pAb (ATL-HPA054666) Datasheet (External Link) |
Vendor Page | Anti PACRGL pAb (ATL-HPA054666) |