Anti PACRGL pAb (ATL-HPA054666)

Atlas Antibodies

Catalog No.:
ATL-HPA054666-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: PARK2 co-regulated-like
Gene Name: PACRGL
Alternative Gene Name: C4orf28, MGC29898
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029089: 80%, ENSRNOG00000004140: 77%
Entrez Gene ID: 133015
Uniprot ID: Q8N7B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIP
Gene Sequence LLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIP
Gene ID - Mouse ENSMUSG00000029089
Gene ID - Rat ENSRNOG00000004140
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PACRGL pAb (ATL-HPA054666)
Datasheet Anti PACRGL pAb (ATL-HPA054666) Datasheet (External Link)
Vendor Page Anti PACRGL pAb (ATL-HPA054666) at Atlas Antibodies

Documents & Links for Anti PACRGL pAb (ATL-HPA054666)
Datasheet Anti PACRGL pAb (ATL-HPA054666) Datasheet (External Link)
Vendor Page Anti PACRGL pAb (ATL-HPA054666)