Anti PABPC1L pAb (ATL-HPA066650)

Atlas Antibodies

Catalog No.:
ATL-HPA066650-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: poly(A) binding protein, cytoplasmic 1-like
Gene Name: PABPC1L
Alternative Gene Name: C20orf119, dJ1069P2.3, ePAB, PABPC1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054582: 58%, ENSRNOG00000012750: 49%
Entrez Gene ID: 80336
Uniprot ID: Q4VXU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP
Gene Sequence ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP
Gene ID - Mouse ENSMUSG00000054582
Gene ID - Rat ENSRNOG00000012750
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PABPC1L pAb (ATL-HPA066650)
Datasheet Anti PABPC1L pAb (ATL-HPA066650) Datasheet (External Link)
Vendor Page Anti PABPC1L pAb (ATL-HPA066650) at Atlas Antibodies

Documents & Links for Anti PABPC1L pAb (ATL-HPA066650)
Datasheet Anti PABPC1L pAb (ATL-HPA066650) Datasheet (External Link)
Vendor Page Anti PABPC1L pAb (ATL-HPA066650)