Anti P4HTM pAb (ATL-HPA007199)

Atlas Antibodies

Catalog No.: ATL-HPA007199-100

Protein Description: prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum)
Gene Name: P4HTM
Alternative Gene Name: EGLN4, FLJ20262, HIFPH4, P4H-TM, PH-4, PH4, PHD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006675: 85%, ENSRNOG00000020249: 86%
Entrez Gene ID: 54681
Uniprot ID: Q9NXG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP
• Gene Sequence: KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP
• Gene ID - Mouse: ENSMUSG00000006675
• Gene ID - Rat: ENSRNOG00000020249
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.