Anti P4HA3 pAb (ATL-HPA007897)

Atlas Antibodies

Catalog No.:
ATL-HPA007897-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: prolyl 4-hydroxylase, alpha polypeptide III
Gene Name: P4HA3
Alternative Gene Name: C-P4Halpha(III)
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051048: 93%, ENSRNOG00000017118: 92%
Entrez Gene ID: 283208
Uniprot ID: Q7Z4N8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKV
Gene Sequence TTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLTGDDCFQVGKV
Gene ID - Mouse ENSMUSG00000051048
Gene ID - Rat ENSRNOG00000017118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti P4HA3 pAb (ATL-HPA007897)
Datasheet Anti P4HA3 pAb (ATL-HPA007897) Datasheet (External Link)
Vendor Page Anti P4HA3 pAb (ATL-HPA007897) at Atlas Antibodies

Documents & Links for Anti P4HA3 pAb (ATL-HPA007897)
Datasheet Anti P4HA3 pAb (ATL-HPA007897) Datasheet (External Link)
Vendor Page Anti P4HA3 pAb (ATL-HPA007897)
Citations for Anti P4HA3 pAb (ATL-HPA007897) – 1 Found
van den Akker, Guus G H; Surtel, Don A M; Cremers, Andy; Richardson, Stephen M; Hoyland, Judith A; van Rhijn, Lodewijk W; Voncken, Jan Willem; Welting, Tim J M. Novel Immortal Cell Lines Support Cellular Heterogeneity in the Human Annulus Fibrosus. Plos One. 11(1):e0144497.  PubMed