Anti P4HA1 pAb (ATL-HPA007599 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007599-25

Protein Description: prolyl 4-hydroxylase, alpha polypeptide I
Gene Name: P4HA1
Alternative Gene Name: C-P4Halpha(I), P4HA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019916: 97%, ENSRNOG00000050655: 97%
Entrez Gene ID: 5033
Uniprot ID: P13674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDC
• Gene Sequence: FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDC
• Gene ID - Mouse: ENSMUSG00000019916
• Gene ID - Rat: ENSRNOG00000050655
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti P4HA1 pAb (ATL-HPA007599 w/enhanced validation) – 1 Found

Eriksson, Johanna; Le Joncour, Vadim; Jahkola, Tiina; Juteau, Susanna; Laakkonen, Pirjo; Saksela, Olli; Hölttä, Erkki. Prolyl 4-hydroxylase subunit alpha 1 (P4HA1) is a biomarker of poor prognosis in primary melanomas, and its depletion inhibits melanoma cell invasion and disrupts tumor blood vessel walls. Molecular Oncology. 2020;14(4):742-762.