Anti P2RY11 pAb (ATL-HPA014232)

Atlas Antibodies

Catalog No.: ATL-HPA014232-25

Protein Description: purinergic receptor P2Y, G-protein coupled, 11
Gene Name: P2RY11
Alternative Gene Name: P2Y11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073436: 24%, ENSRNOG00000056854: 24%
Entrez Gene ID: 5032
Uniprot ID: Q96G91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ
• Gene Sequence: VLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ
• Gene ID - Mouse: ENSMUSG00000073436
• Gene ID - Rat: ENSRNOG00000056854
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.