Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA065766-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: purinergic receptor P2Y, G-protein coupled, 10
Gene Name: P2RY10
Alternative Gene Name: P2Y10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050921: 91%, ENSRNOG00000037839: 91%
Entrez Gene ID: 27334
Uniprot ID: O00398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
Gene Sequence MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
Gene ID - Mouse ENSMUSG00000050921
Gene ID - Rat ENSRNOG00000037839
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation)
Datasheet Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation)
Datasheet Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation)