Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA065766-25

Protein Description: purinergic receptor P2Y, G-protein coupled, 10
Gene Name: P2RY10
Alternative Gene Name: P2Y10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050921: 91%, ENSRNOG00000037839: 91%
Entrez Gene ID: 27334
Uniprot ID: O00398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
• Gene Sequence: MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
• Gene ID - Mouse: ENSMUSG00000050921
• Gene ID - Rat: ENSRNOG00000037839
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.