Anti OXT pAb (ATL-HPA071892)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071892-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: OXT
Alternative Gene Name: OT, OT-NPI, OXT-NPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037727: 95%, ENSRNOG00000021225: 95%
Entrez Gene ID: 5020
Uniprot ID: P01178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS |
Gene Sequence | ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS |
Gene ID - Mouse | ENSMUSG00000037727 |
Gene ID - Rat | ENSRNOG00000021225 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OXT pAb (ATL-HPA071892) | |
Datasheet | Anti OXT pAb (ATL-HPA071892) Datasheet (External Link) |
Vendor Page | Anti OXT pAb (ATL-HPA071892) at Atlas Antibodies |
Documents & Links for Anti OXT pAb (ATL-HPA071892) | |
Datasheet | Anti OXT pAb (ATL-HPA071892) Datasheet (External Link) |
Vendor Page | Anti OXT pAb (ATL-HPA071892) |