Anti OXT pAb (ATL-HPA071892)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071892-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: OXT
Alternative Gene Name: OT, OT-NPI, OXT-NPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037727: 95%, ENSRNOG00000021225: 95%
Entrez Gene ID: 5020
Uniprot ID: P01178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS |
| Gene Sequence | ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS |
| Gene ID - Mouse | ENSMUSG00000037727 |
| Gene ID - Rat | ENSRNOG00000021225 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OXT pAb (ATL-HPA071892) | |
| Datasheet | Anti OXT pAb (ATL-HPA071892) Datasheet (External Link) |
| Vendor Page | Anti OXT pAb (ATL-HPA071892) at Atlas Antibodies |
| Documents & Links for Anti OXT pAb (ATL-HPA071892) | |
| Datasheet | Anti OXT pAb (ATL-HPA071892) Datasheet (External Link) |
| Vendor Page | Anti OXT pAb (ATL-HPA071892) |