Anti OXT pAb (ATL-HPA071892)

Atlas Antibodies

Catalog No.:
ATL-HPA071892-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: oxytocin/neurophysin I prepropeptide
Gene Name: OXT
Alternative Gene Name: OT, OT-NPI, OXT-NPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037727: 95%, ENSRNOG00000021225: 95%
Entrez Gene ID: 5020
Uniprot ID: P01178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS
Gene Sequence ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS
Gene ID - Mouse ENSMUSG00000037727
Gene ID - Rat ENSRNOG00000021225
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OXT pAb (ATL-HPA071892)
Datasheet Anti OXT pAb (ATL-HPA071892) Datasheet (External Link)
Vendor Page Anti OXT pAb (ATL-HPA071892) at Atlas Antibodies

Documents & Links for Anti OXT pAb (ATL-HPA071892)
Datasheet Anti OXT pAb (ATL-HPA071892) Datasheet (External Link)
Vendor Page Anti OXT pAb (ATL-HPA071892)