Anti OXR1 pAb (ATL-HPA027380 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027380-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: oxidation resistance 1
Gene Name: OXR1
Alternative Gene Name: TLDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022307: 51%, ENSRNOG00000056487: 61%
Entrez Gene ID: 55074
Uniprot ID: Q8N573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIREELVSSDELRQDKSSGASSESVQTVNQAEVESLTVKSESTGTPGHLRSDTEHSTNEVGTLCHKTDLNNLEMAIKEDQIADNFQGISGPKE
Gene Sequence PIREELVSSDELRQDKSSGASSESVQTVNQAEVESLTVKSESTGTPGHLRSDTEHSTNEVGTLCHKTDLNNLEMAIKEDQIADNFQGISGPKE
Gene ID - Mouse ENSMUSG00000022307
Gene ID - Rat ENSRNOG00000056487
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OXR1 pAb (ATL-HPA027380 w/enhanced validation)
Datasheet Anti OXR1 pAb (ATL-HPA027380 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OXR1 pAb (ATL-HPA027380 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti OXR1 pAb (ATL-HPA027380 w/enhanced validation)
Datasheet Anti OXR1 pAb (ATL-HPA027380 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OXR1 pAb (ATL-HPA027380 w/enhanced validation)