Anti OXLD1 pAb (ATL-HPA056878)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056878-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: OXLD1
Alternative Gene Name: C17orf90, MGC104712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039670: 46%, ENSRNOG00000047517: 49%
Entrez Gene ID: 339229
Uniprot ID: Q5BKU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPPELQPPTNC |
| Gene Sequence | FLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPPELQPPTNC |
| Gene ID - Mouse | ENSMUSG00000039670 |
| Gene ID - Rat | ENSRNOG00000047517 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OXLD1 pAb (ATL-HPA056878) | |
| Datasheet | Anti OXLD1 pAb (ATL-HPA056878) Datasheet (External Link) |
| Vendor Page | Anti OXLD1 pAb (ATL-HPA056878) at Atlas Antibodies |
| Documents & Links for Anti OXLD1 pAb (ATL-HPA056878) | |
| Datasheet | Anti OXLD1 pAb (ATL-HPA056878) Datasheet (External Link) |
| Vendor Page | Anti OXLD1 pAb (ATL-HPA056878) |