Anti OXLD1 pAb (ATL-HPA056878)

Atlas Antibodies

Catalog No.: ATL-HPA056878-25

Protein Description: oxidoreductase-like domain containing 1
Gene Name: OXLD1
Alternative Gene Name: C17orf90, MGC104712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039670: 46%, ENSRNOG00000047517: 49%
Entrez Gene ID: 339229
Uniprot ID: Q5BKU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPPELQPPTNC
• Gene Sequence: FLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPPELQPPTNC
• Gene ID - Mouse: ENSMUSG00000039670
• Gene ID - Rat: ENSRNOG00000047517
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.