Anti OXCT1 pAb (ATL-HPA061425 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA061425-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: 3-oxoacid CoA transferase 1
Gene Name: OXCT1
Alternative Gene Name: OXCT, SCOT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022186: 72%, ENSRNOG00000043094: 69%
Entrez Gene ID: 5019
Uniprot ID: P55809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA
Gene Sequence ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA
Gene ID - Mouse ENSMUSG00000022186
Gene ID - Rat ENSRNOG00000043094
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OXCT1 pAb (ATL-HPA061425 w/enhanced validation)
Datasheet Anti OXCT1 pAb (ATL-HPA061425 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OXCT1 pAb (ATL-HPA061425 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti OXCT1 pAb (ATL-HPA061425 w/enhanced validation)
Datasheet Anti OXCT1 pAb (ATL-HPA061425 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OXCT1 pAb (ATL-HPA061425 w/enhanced validation)