Anti OVOL1 pAb (ATL-HPA003984)

Atlas Antibodies

Catalog No.:
ATL-HPA003984-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ovo-like zinc finger 1
Gene Name: OVOL1
Alternative Gene Name: HOVO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024922: 94%, ENSRNOG00000020669: 89%
Entrez Gene ID: 5017
Uniprot ID: O14753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTK
Gene Sequence RAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTK
Gene ID - Mouse ENSMUSG00000024922
Gene ID - Rat ENSRNOG00000020669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OVOL1 pAb (ATL-HPA003984)
Datasheet Anti OVOL1 pAb (ATL-HPA003984) Datasheet (External Link)
Vendor Page Anti OVOL1 pAb (ATL-HPA003984) at Atlas Antibodies

Documents & Links for Anti OVOL1 pAb (ATL-HPA003984)
Datasheet Anti OVOL1 pAb (ATL-HPA003984) Datasheet (External Link)
Vendor Page Anti OVOL1 pAb (ATL-HPA003984)
Citations for Anti OVOL1 pAb (ATL-HPA003984) – 2 Found
Renaud, Stephen J; Chakraborty, Damayanti; Mason, Clifford W; Rumi, M A Karim; Vivian, Jay L; Soares, Michael J. OVO-like 1 regulates progenitor cell fate in human trophoblast development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(45):E6175-84.  PubMed
Murata, Maho; Ito, Takamichi; Tanaka, Yuka; Yamamura, Kazuhiko; Furue, Kazuhisa; Furue, Masutaka. OVOL2-Mediated ZEB1 Downregulation May Prevent Promotion of Actinic Keratosis to Cutaneous Squamous Cell Carcinoma. Journal Of Clinical Medicine. 2020;9(3)  PubMed