Anti OVOL1 pAb (ATL-HPA003984)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003984-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: OVOL1
Alternative Gene Name: HOVO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024922: 94%, ENSRNOG00000020669: 89%
Entrez Gene ID: 5017
Uniprot ID: O14753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTK |
| Gene Sequence | RAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTK |
| Gene ID - Mouse | ENSMUSG00000024922 |
| Gene ID - Rat | ENSRNOG00000020669 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OVOL1 pAb (ATL-HPA003984) | |
| Datasheet | Anti OVOL1 pAb (ATL-HPA003984) Datasheet (External Link) |
| Vendor Page | Anti OVOL1 pAb (ATL-HPA003984) at Atlas Antibodies |
| Documents & Links for Anti OVOL1 pAb (ATL-HPA003984) | |
| Datasheet | Anti OVOL1 pAb (ATL-HPA003984) Datasheet (External Link) |
| Vendor Page | Anti OVOL1 pAb (ATL-HPA003984) |
| Citations for Anti OVOL1 pAb (ATL-HPA003984) – 2 Found |
| Renaud, Stephen J; Chakraborty, Damayanti; Mason, Clifford W; Rumi, M A Karim; Vivian, Jay L; Soares, Michael J. OVO-like 1 regulates progenitor cell fate in human trophoblast development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(45):E6175-84. PubMed |
| Murata, Maho; Ito, Takamichi; Tanaka, Yuka; Yamamura, Kazuhiko; Furue, Kazuhisa; Furue, Masutaka. OVOL2-Mediated ZEB1 Downregulation May Prevent Promotion of Actinic Keratosis to Cutaneous Squamous Cell Carcinoma. Journal Of Clinical Medicine. 2020;9(3) PubMed |