Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062205-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: OVGP1
Alternative Gene Name: CHIT5, MUC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045103: 26%, ENSRNOG00000022921: 28%
Entrez Gene ID: 5016
Uniprot ID: Q12889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE |
| Gene Sequence | GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE |
| Gene ID - Mouse | ENSMUSG00000045103 |
| Gene ID - Rat | ENSRNOG00000022921 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation) | |
| Datasheet | Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation) | |
| Datasheet | Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation) |
| Citations for Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation) – 2 Found |
| Yucer, Nur; Holzapfel, Marie; Jenkins Vogel, Tilley; Lenaeus, Lindsay; Ornelas, Loren; Laury, Anna; Sareen, Dhruv; Barrett, Robert; Karlan, Beth Y; Svendsen, Clive N. Directed Differentiation of Human Induced Pluripotent Stem Cells into Fallopian Tube Epithelium. Scientific Reports. 2017;7(1):10741. PubMed |
| Yucer, Nur; Ahdoot, Rodney; Workman, Michael J; Laperle, Alexander H; Recouvreux, Maria S; Kurowski, Kathleen; Naboulsi, Diana J; Liang, Victoria; Qu, Ying; Plummer, Jasmine T; Gayther, Simon A; Orsulic, Sandra; Karlan, Beth Y; Svendsen, Clive N. Human iPSC-derived fallopian tube organoids with BRCA1 mutation recapitulate early-stage carcinogenesis. Cell Reports. 2021;37(13):110146. PubMed |