Anti OVGP1 pAb (ATL-HPA031666)

Atlas Antibodies

Catalog No.:
ATL-HPA031666-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: oviductal glycoprotein 1
Gene Name: OVGP1
Alternative Gene Name: CHIT5, MUC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074340: 68%, ENSRNOG00000033162: 33%
Entrez Gene ID: 5016
Uniprot ID: Q12889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPER
Gene Sequence DNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPER
Gene ID - Mouse ENSMUSG00000074340
Gene ID - Rat ENSRNOG00000033162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OVGP1 pAb (ATL-HPA031666)
Datasheet Anti OVGP1 pAb (ATL-HPA031666) Datasheet (External Link)
Vendor Page Anti OVGP1 pAb (ATL-HPA031666) at Atlas Antibodies

Documents & Links for Anti OVGP1 pAb (ATL-HPA031666)
Datasheet Anti OVGP1 pAb (ATL-HPA031666) Datasheet (External Link)
Vendor Page Anti OVGP1 pAb (ATL-HPA031666)