Anti OVCA2 pAb (ATL-HPA059002)

Atlas Antibodies

SKU:
ATL-HPA059002-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ovarian tumor suppressor candidate 2
Gene Name: OVCA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038268: 85%, ENSRNOG00000000852: 31%
Entrez Gene ID: 124641
Uniprot ID: Q8WZ82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE
Gene Sequence PLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE
Gene ID - Mouse ENSMUSG00000038268
Gene ID - Rat ENSRNOG00000000852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti OVCA2 pAb (ATL-HPA059002)
Datasheet Anti OVCA2 pAb (ATL-HPA059002) Datasheet (External Link)
Vendor Page Anti OVCA2 pAb (ATL-HPA059002) at Atlas Antibodies

Documents & Links for Anti OVCA2 pAb (ATL-HPA059002)
Datasheet Anti OVCA2 pAb (ATL-HPA059002) Datasheet (External Link)
Vendor Page Anti OVCA2 pAb (ATL-HPA059002)