Anti OTUD7B pAb (ATL-HPA076357)

Atlas Antibodies

Catalog No.:
ATL-HPA076357-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: OTU deubiquitinase 7B
Gene Name: OTUD7B
Alternative Gene Name: CEZANNE, ZA20D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038495: 90%, ENSRNOG00000042068: 91%
Entrez Gene ID: 56957
Uniprot ID: Q6GQQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDA
Gene Sequence QGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDA
Gene ID - Mouse ENSMUSG00000038495
Gene ID - Rat ENSRNOG00000042068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OTUD7B pAb (ATL-HPA076357)
Datasheet Anti OTUD7B pAb (ATL-HPA076357) Datasheet (External Link)
Vendor Page Anti OTUD7B pAb (ATL-HPA076357) at Atlas Antibodies

Documents & Links for Anti OTUD7B pAb (ATL-HPA076357)
Datasheet Anti OTUD7B pAb (ATL-HPA076357) Datasheet (External Link)
Vendor Page Anti OTUD7B pAb (ATL-HPA076357)