Anti OTUD1 pAb (ATL-HPA038503)

Atlas Antibodies

Catalog No.:
ATL-HPA038503-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: OTU deubiquitinase 1
Gene Name: OTUD1
Alternative Gene Name: DUBA7, OTDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043415: 97%, ENSRNOG00000016950: 97%
Entrez Gene ID: 220213
Uniprot ID: Q5VV17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSM
Gene Sequence HLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSM
Gene ID - Mouse ENSMUSG00000043415
Gene ID - Rat ENSRNOG00000016950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OTUD1 pAb (ATL-HPA038503)
Datasheet Anti OTUD1 pAb (ATL-HPA038503) Datasheet (External Link)
Vendor Page Anti OTUD1 pAb (ATL-HPA038503) at Atlas Antibodies

Documents & Links for Anti OTUD1 pAb (ATL-HPA038503)
Datasheet Anti OTUD1 pAb (ATL-HPA038503) Datasheet (External Link)
Vendor Page Anti OTUD1 pAb (ATL-HPA038503)