Anti OTOP2 pAb (ATL-HPA053090)

Atlas Antibodies

Catalog No.:
ATL-HPA053090-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: otopetrin 2
Gene Name: OTOP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050201: 64%, ENSRNOG00000028121: 60%
Entrez Gene ID: 92736
Uniprot ID: Q7RTS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DESVHQSHSYSSSHSNASHARLISDQHADNPVGGDSCLCSTAVCQIFQQ
Gene Sequence DESVHQSHSYSSSHSNASHARLISDQHADNPVGGDSCLCSTAVCQIFQQ
Gene ID - Mouse ENSMUSG00000050201
Gene ID - Rat ENSRNOG00000028121
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OTOP2 pAb (ATL-HPA053090)
Datasheet Anti OTOP2 pAb (ATL-HPA053090) Datasheet (External Link)
Vendor Page Anti OTOP2 pAb (ATL-HPA053090) at Atlas Antibodies

Documents & Links for Anti OTOP2 pAb (ATL-HPA053090)
Datasheet Anti OTOP2 pAb (ATL-HPA053090) Datasheet (External Link)
Vendor Page Anti OTOP2 pAb (ATL-HPA053090)