Anti OTOP2 pAb (ATL-HPA053090)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053090-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: OTOP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050201: 64%, ENSRNOG00000028121: 60%
Entrez Gene ID: 92736
Uniprot ID: Q7RTS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DESVHQSHSYSSSHSNASHARLISDQHADNPVGGDSCLCSTAVCQIFQQ |
Gene Sequence | DESVHQSHSYSSSHSNASHARLISDQHADNPVGGDSCLCSTAVCQIFQQ |
Gene ID - Mouse | ENSMUSG00000050201 |
Gene ID - Rat | ENSRNOG00000028121 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OTOP2 pAb (ATL-HPA053090) | |
Datasheet | Anti OTOP2 pAb (ATL-HPA053090) Datasheet (External Link) |
Vendor Page | Anti OTOP2 pAb (ATL-HPA053090) at Atlas Antibodies |
Documents & Links for Anti OTOP2 pAb (ATL-HPA053090) | |
Datasheet | Anti OTOP2 pAb (ATL-HPA053090) Datasheet (External Link) |
Vendor Page | Anti OTOP2 pAb (ATL-HPA053090) |