Anti OTOF pAb (ATL-HPA012410)

Atlas Antibodies

Catalog No.:
ATL-HPA012410-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: otoferlin
Gene Name: OTOF
Alternative Gene Name: DFNB6, DFNB9, FER1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062372: 97%, ENSRNOG00000009967: 98%
Entrez Gene ID: 9381
Uniprot ID: Q9HC10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLPPINGPVDVDRGPIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNL
Gene Sequence PIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGKADLPPINGPVDVDRGPIMPVPMGIRPVLSKYRVEVLFWGLRDLKRVNL
Gene ID - Mouse ENSMUSG00000062372
Gene ID - Rat ENSRNOG00000009967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OTOF pAb (ATL-HPA012410)
Datasheet Anti OTOF pAb (ATL-HPA012410) Datasheet (External Link)
Vendor Page Anti OTOF pAb (ATL-HPA012410) at Atlas Antibodies

Documents & Links for Anti OTOF pAb (ATL-HPA012410)
Datasheet Anti OTOF pAb (ATL-HPA012410) Datasheet (External Link)
Vendor Page Anti OTOF pAb (ATL-HPA012410)