Anti OSTM1 pAb (ATL-HPA010851 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA010851-25

Protein Description: osteopetrosis associated transmembrane protein 1
Gene Name: OSTM1
Alternative Gene Name: GL, HSPC019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038280: 85%, ENSRNOG00000037647: 89%
Entrez Gene ID: 28962
Uniprot ID: Q86WC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVP
• Gene Sequence: REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVP
• Gene ID - Mouse: ENSMUSG00000038280
• Gene ID - Rat: ENSRNOG00000037647
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OSTM1 pAb (ATL-HPA010851 w/enhanced validation) – 2 Found

Majumdar, Amitabha; Capetillo-Zarate, Estibaliz; Cruz, Dana; Gouras, Gunnar K; Maxfield, Frederick R. Degradation of Alzheimer's amyloid fibrils by microglia requires delivery of ClC-7 to lysosomes. Molecular Biology Of The Cell. 2011;22(10):1664-76. 

Bosman, Erika A; Estabel, Jeanne; Ismail, Ozama; Podrini, Christine; White, Jacqueline K; Steel, Karen P. Omi, a recessive mutation on chromosome 10, is a novel allele of Ostm1. Mammalian Genome : Official Journal Of The International Mammalian Genome Society. 2013;24(1-2):44-53.