Anti OSR2 pAb (ATL-HPA063486)

Atlas Antibodies

SKU: ATL-HPA063486-25

• 
• 

Protein Description: odd-skipped related transciption factor 2
Gene Name: OSR2
Alternative Gene Name: FLJ90037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028949: 31%, ENSRNOG00000018372: 31%
Entrez Gene ID: 116039
Uniprot ID: Q8N2R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THRSQELRGAAATEGFLYVLLSHWVFVGAPRPPASDSWKKGLVPSAPPASRKMGSKALPAPIPLHPSLQL
• Gene Sequence: THRSQELRGAAATEGFLYVLLSHWVFVGAPRPPASDSWKKGLVPSAPPASRKMGSKALPAPIPLHPSLQL
• Gene ID - Mouse: ENSMUSG00000028949
• Gene ID - Rat: ENSRNOG00000018372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.